TFPI Protein, Mouse (HEK293, His)

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa). In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-His labeled tag.

TFPI protein serves as a potent inhibitor in the coagulation cascade by directly inhibiting factor X (Xa). In a Xa-dependent manner, it further inhibits the activity of VIIa/tissue factor, potentially through the formation of a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. Beyond its role in antithrombotic action, TFPI exhibits the capability to associate with lipoproteins in plasma, suggesting its involvement in regulating hemostasis and clotting processes.

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate Mca-RPKPVE-Nval-WRK(Dnp)-NH2 and the IC₅₀ value is < 0.5 nM.

Mouse

HEK293

C-His

NP_035706.1 (L29-K289)

21788  [NCBI]

LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK

Approximately 45 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.