1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β TGF-β
  5. TGF-β3
  6. TGF beta 3/TGFB3 Protein, Human/Mouse/Rat (HEK293)

TGF beta 3/TGFB3 Protein, Human/Mouse/Rat (HEK293)

Cat. No.: HY-P7120
Handling Instructions Technical Support

TGF-β3 (transforming growth factor-β3) is a member of a TGF­-beta superfamily subgroup that performs many cellular functions. TGF-β3 has a role in embryogenesis and cell differentiation. TGF-β3 also plays a critical role in palatogenesis, the wound healing process. TGF-β3 is capable of binding directly to the type II receptor (TβRII). TGF beta 3/TGFB3 Protein, Human/Mouse/Rat (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A301-S412).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE TGF beta 3/TGFB3 Protein, Human/Mouse/Rat (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TGF-β3 (transforming growth factor-β3) is a member of a TGF­-beta superfamily subgroup that performs many cellular functions. TGF-β3 has a role in embryogenesis and cell differentiation. TGF-β3 also plays a critical role in palatogenesis, the wound healing process. TGF-β3 is capable of binding directly to the type II receptor (TβRII)[1][2]. TGF beta 3/TGFB3 Protein, Human/Mouse/Rat (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A301-S412).

Background

Three TGF-β isoforms have been found in mammals: TGF-β1, 2, and 3, which are structurally and functionally similar. TGF-β3 is important in embryonic development, scarless repair of injury in the embryo, adult wound healing and tissue homeostasis. It has an important role in regulating cell migration, angiogenesis, epithelial-mesenchymal transition, apoptosis, modulation of immune function, extracellular matrix (ECM) production and the regulation of ECM remodelling; biological processes that are often required for tumour growth and maintenance[1][2].
As with all members of the family, TGF-β3 is highly conserved across species, with mouse, rat and human TGF-β3 demonstrating >97% sequence homology.
TGF-β3 is released from LAP by integrins: integrin-binding results in distortion of the LAP chain and subsequent release of the active TGF-β3. TGF-β3 is capable of binding directly to the type II receptor (TβRII). TGF-β3 expression increases in fetal wound healing and reduces fibronectin and collagen I and III deposition, and also improves the architecture of the neodermis. Fibroblasts are key cells in the wound healing process. In addition, TGF-β3 may actually play a protective role against tumourigenesis in a range of tissues including the skin, breast, oral and gastric mucosa. TGF-β3 is a more potent inhibitor of DNA synthesis in human keratinocytes compared to TGF-β1 and TGF-β2. TGF-β3 mRNA is expressed in lymphocytes such as CD4+ T cells, CD8+ T cells, γδT cells, and B cells. TGF-β3 has the potential to regulate systemic autoimmune diseases by inhibiting B cells. Moreover, during palatogenesis, TGF-β3 is supposed to transduce signals via both canonical Smad-dependent and non-canonical Smad-independent signaling. In human B cells, TGF-β3 induces phosphorylation of Smad1/5 along with Smad2 and Smad3[1][2][3].
TGF-β3 is involved in cell differentiation, embryogenesis and development. TGF-β3 is crucial in tissue regeneration and scarless tissue repair. TGF-β3 is also involved in palatogenesis, chondrogenesis, and pulmonary development. Furthermore, TGF-β3 plays a role in cancer and immune diseases[1][2][3].

In Vitro

Recombinant TGF-β3 (0.01-10 ng/mL) induces fibronectin expression in leiomyoma cells and directly stimulates leiomyoma cell proliferation[4].
Recombinant TGF-β3 (0.5 ng/mL) promotes mRNA expression, and increased protein levels of osteocalcin (OCN) and type I collagen (COL I) in mouse pulpal mesenchymal cells. TGF-β3 also induces the expression of dentin sialophosphoprotein and dentin matrix protein 1[5].
Recombinant TGF-β3 (0.005-3 ng/mL) adds to rat Sertoli cells cultured in vitro on Matrigel-coated bicameral units perturbed the inter-Sertoli tight junction (TJ) permeability barrier dose-dependently. Moreover, the presence of TGF-β3 also inhibits the transient and/or basal expression of several TJ-associated proteins, which include occludin, zonula occludens-1, and claudin-11 when inter-Sertoli TJs are being assembled in vitro[8].

In Vivo

Recombinant TGF-β3 (1 μg/kg; i.p; once every week) decelerates the progress of radiation-induced pulmonary fibrosis and hindered the recruitment of fibrocytes to lung in radiation-induced mouse pulmonary fibrosis[6].
Recombinant TGF-β3 (local infiltration (0.5 μg, 1.0 μg, 2.5 μg, and 50 μg) or intravenous application (500 μg/kg); for 7 days) treatment accelerates gastric ulcer healing in rats[7].

Biological Activity

1.The ED50 is <0.2 ng/mL as measured in a cell proliferation assay using mouse HT-2 cells.
2.Measured by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells. The ED50 for this effect is 10-80 pg/mL.

Species

Human; Rat; Mouse

Source

HEK293

Tag

Tag Free

Accession

P10600 (A301-S412,Y340F)

Gene ID
Molecular Construction
N-term
TGFB3 (A301-S412,Y340F)
Accession # P10600
C-term
Synonyms
rHuTGF-β3; TGFB3; LAP
AA Sequence

ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

Molecular Weight

Approximately 12.7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 4 mM HCl or 50 mM Glycine-HCl, 150 mM NaCl, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TGF beta 3/TGFB3 Protein, Human/Mouse/Rat (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGF beta 3/TGFB3 Protein, Human/Mouse/Rat (HEK293)
Cat. No.:
HY-P7120
Quantity:
MCE Japan Authorized Agent: