TIGIT Protein, Cynomolgus (HEK293, His)

Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions, therefore being involved in biological processes such as down-regulation of T cell activation or cardiac and neuronal development. TIGIT Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TIGIT Protein, Cynomolgus (HEK293, His) is 121 a.a., with molecular weight of 16-30 kDa.

Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions. Some member of Ig-like domain-containing protein can bind to membrane Ig signaling receptors and down-regulating T cell activation through competing with Ig proteins for binding, and Ig-like domain-containing protein such as neuregulin proteins can bind to heparin through IgL-like domain, contributing to cardiac and neuronal development^[1][2].

Cynomolgus

HEK293

C-6*His

G7NXM4 (M89-P209)

/

MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP

16-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.