2. Recombinant Proteins
  3. Immune Checkpoint Proteins
  4. Inhibitory Checkpoint Molecules
  5. TIGIT Protein
  6. TIGIT Protein, Cynomolgus (HEK293, Fc)

TIGIT Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P76674
Handling Instructions

TIGIT is a receptor of the Ig superfamily that plays a key role in restricting adaptive and innate immunity. TIGIT can be used as an immune modulator to inhibit the activity of T cells and NK cells, and also regulates the recognition of cancer cells. TIGIT consists of an extracellular immunoglobulin (Ig) variable domain, a type 1 transmembrane domain, and a cytoplasmic tail with two inhibitory motifs. TIGIT Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIGIT is a receptor of the Ig superfamily that plays a key role in restricting adaptive and innate immunity. TIGIT can be used as an immune modulator to inhibit the activity of T cells and NK cells, and also regulates the recognition of cancer cells. TIGIT consists of an extracellular immunoglobulin (Ig) variable domain, a type 1 transmembrane domain, and a cytoplasmic tail with two inhibitory motifs. TIGIT Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.
Background

TIGIT binds to the poliovirus receptor (PVR) or PVR2, which can inhibit the activity of T and natural killer (NK) cells. In addition, TIGIT also regulates the recognition of cancer cells. Therefore, TIGIT is considered to be a promising target for cancer immunotherapy. TIGIT has three ligands: CD155, CD112, and CD113. The binding of TIGIT to CD155 promotes the direct and indirect downregulation of T cell response. In summary, TIGIT can act as an immune modulator and play a key role in limiting adaptive immunity and innate immunity[1][2][3].
Species

Cynomolgus
Source

HEK293
Tag

C-hFc
Accession

XP_015300911.1 (K27-P209)
Gene ID
Molecular Construction
N-term
TIGIT (K27-P209)
Accession # XP_015300911.1
hFc
C-term
Synonyms
T cell immunoreceptor with Ig and ITIM domains; TIGIT; VSIG9; VSTM3
AA Sequence

KPGFSETVFSHRLSFTVLSAVGYFRWQKRPHLLPVSPLGRSMRWCLFLIWAQGLRQAPLASGMMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP

Molecular Weight

Approximately 47.2 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

TIGIT Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIGIT Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P76674
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.