TIGIT Protein, Cynomolgus (HEK293, Fc)

TIGIT is a receptor of the Ig superfamily that plays a key role in restricting adaptive and innate immunity. TIGIT can be used as an immune modulator to inhibit the activity of T cells and NK cells, and also regulates the recognition of cancer cells. TIGIT consists of an extracellular immunoglobulin (Ig) variable domain, a type 1 transmembrane domain, and a cytoplasmic tail with two inhibitory motifs. TIGIT Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.

TIGIT binds to the poliovirus receptor (PVR) or PVR2, which can inhibit the activity of T and natural killer (NK) cells. In addition, TIGIT also regulates the recognition of cancer cells. Therefore, TIGIT is considered to be a promising target for cancer immunotherapy. TIGIT has three ligands: CD155, CD112, and CD113. The binding of TIGIT to CD155 promotes the direct and indirect downregulation of T cell response. In summary, TIGIT can act as an immune modulator and play a key role in limiting adaptive immunity and innate immunity^[1][2][3].

Cynomolgus

HEK293

C-hFc

XP_015300911.1 (K27-P209)

102121588  [NCBI]

KPGFSETVFSHRLSFTVLSAVGYFRWQKRPHLLPVSPLGRSMRWCLFLIWAQGLRQAPLASGMMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP

Approximately 47.2 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.