1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. TIGIT Protein
  5. TIGIT Protein, Mouse (HEK293, mFc)

TIGIT Protein, Mouse (HEK293, mFc)

Cat. No.: HY-P77235
SDS COA Handling Instructions

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag. The total length of TIGIT Protein, Mouse (HEK293, mFc) is 125 a.a., with molecular weight of ~39-52 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag. The total length of TIGIT Protein, Mouse (HEK293, mFc) is 125 a.a., with molecular weight of ~39-52 KDa.

Background

TIGIT protein, characterized by its signaling receptor binding activity, operates upstream of negative regulation of T cell activation. Predicted to be active on the cell surface, this protein, orthologous to human TIGIT (T cell immunoreceptor with Ig and ITIM domains), is associated with the modulation of T cell responses. The expression of TIGIT is biased, with notable levels observed in the large intestine, small intestine, and several other tissues, emphasizing its potential role in immune regulation within these contexts.

Biological Activity

Immobilized Recombinant Mouse CD155/PVR at 2.5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse TIGIT Protein. The ED50 for this effect is 88.36 ng/mL.

  • Immobilized Recombinant Mouse CD155/PVR at 2.5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse TIGIT Protein. The ED50 for this effect is 88.36 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-mFc

Accession

NP_001139797 (A17-G141)

Gene ID
Molecular Construction
N-term
TIGIT (A17-G141)
Accession # NP_001139797
mFc
C-term
Synonyms
T cell immunoreceptor with Ig and ITIM domains; TIGIT; VSIG9; VSTM3
AA Sequence

AFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG

Molecular Weight

Approximately 39-52 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TIGIT Protein, Mouse (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIGIT Protein, Mouse (HEK293, mFc)
Cat. No.:
HY-P77235
Quantity:
MCE Japan Authorized Agent: