TIGIT Protein, Mouse (HEK293, mFc)

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag. The total length of TIGIT Protein, Mouse (HEK293, mFc) is 125 a.a., with molecular weight of ~39-52 KDa.

TIGIT protein, characterized by its signaling receptor binding activity, operates upstream of negative regulation of T cell activation. Predicted to be active on the cell surface, this protein, orthologous to human TIGIT (T cell immunoreceptor with Ig and ITIM domains), is associated with the modulation of T cell responses. The expression of TIGIT is biased, with notable levels observed in the large intestine, small intestine, and several other tissues, emphasizing its potential role in immune regulation within these contexts.

Immobilized Recombinant Mouse CD155/PVR at 2.5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse TIGIT Protein. The ED₅₀ for this effect is 88.36 ng/mL.

• 
  Immobilized Recombinant Mouse CD155/PVR at 2.5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse TIGIT Protein. The ED₅₀ for this effect is 88.36 ng/mL.

Mouse

HEK293

C-mFc

NP_001139797 (A17-G141)

100043314  [NCBI]

AFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG

Approximately 39-52 kDa.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.