1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. TIM-3
  5. TIM-3/HAVCR2 Protein, Mouse (HEK293, Fc)

The TIM-3/HAVCR2 protein is a cell surface receptor that regulates immune responses by inhibiting macrophage activation and suppressing Th1-mediated autoimmunity. TIM-3/HAVCR2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TIM-3/HAVCR2 protein is a cell surface receptor that regulates immune responses by inhibiting macrophage activation and suppressing Th1-mediated autoimmunity. TIM-3/HAVCR2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

TIM-3/HAVCR2 protein, a cell surface receptor, plays a pivotal role in modulating both innate and adaptive immune responses. Predominantly considered as having an inhibitory function, the reported stimulating functions suggest a nuanced influence based on cellular context and ligand specificity. It regulates macrophage activation and inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses, promoting immunological tolerance. In CD8+ cells, TIM-3 attenuates TCR-induced signaling by blocking NF-kappaB and NFAT promoter activities, leading to reduced IL-2 secretion. This inhibitory function is proposed to involve its association with LCK, impairing the phosphorylation of TCR subunits. Conversely, TIM-3 has been shown to activate TCR-induced signaling in T-cells, likely implicating ZAP70, LCP2, LCK, and FYN. The receptor for LGALS9, TIM-3's binding to LGALS9 is believed to suppress T-cell responses, leading to apoptosis of antigen-specific cells. Additionally, TIM-3 may recognize phosphatidylserine on apoptotic cells, mediating their phagocytosis, and positively regulates innate immune responses, particularly in dendritic cells. It also plays a role in suppressing nucleic acid-mediated innate immune responses in tumor-infiltrating dendritic cells and negatively regulates NK cell function in LPS-induced endotoxic shock. Interactions with various signaling molecules, including HMGB1, BAG6, PIK3R1, PIK3R2, FYN, and ILF3, further contribute to the intricate regulatory functions of TIM-3 in immune responses.

Biological Activity

Immobilized Human TIM-3, His Tag at 0.2 μg/mL (100 μL/well) can bind Anti-TIM3 Antibody. The ED50 of human TIM-3 protein is 1.333 ng/mL, corresponding to a specific activity is 7.5019×105 units/mg.

  • Immobilized Human TIM-3, His Tag at 0.2 μg/mL (100 μL/well) can bind Anti-TIM3 Antibody. The ED50 of human TIM-3 protein is 1.333 ng/mL, corresponding to a specific activity is 7.5019×105 units/mg.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q8VIM0-1 (R20-R191)

Gene ID
Molecular Construction
N-term
TIM-3 (R20-R191)
Accession # Q8VIM0-1
hFc
C-term
Synonyms
Hepatitis A virus cellular receptor 2 homolog; HAVcr-2; T-cell immunoglobulin and mucin domain-containing protein 3; T-cell immunoglobulin mucin receptor 3; T-cell membrane protein 3; Tim3; Timd3
AA Sequence

RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR

Molecular Weight

50-80 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TIM-3/HAVCR2 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIM-3/HAVCR2 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70826
Quantity:
MCE Japan Authorized Agent: