TIMP-1 Protein, Mouse (HEK293)

TIMP-1 is a metalloproteinase inhibitor that irreversibly inactivates collagenase and other metalloproteinases by binding to their catalytic zinc cofactor.It regulates MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16 and affects cellular processes such as differentiation, migration and cell death.TIMP-1 Protein, Mouse (HEK293) is the recombinant mouse-derived TIMP-1 protein, expressed by HEK293 , with tag free.

TIMP-1, a metalloproteinase inhibitor, exerts its regulatory function by forming one-to-one complexes with target metalloproteinases, such as collagenases, leading to the irreversible inactivation of these enzymes by binding to their catalytic zinc cofactor. This inhibitory action encompasses a spectrum of metalloproteinases, including MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13, and MMP16, with no observed effect on MMP14. Beyond its role as an enzyme inhibitor, TIMP-1 serves as a growth factor, influencing diverse cellular processes like differentiation, migration, and cell death. It activates signaling cascades through interactions with CD63 and ITGB1, implicating its involvement in integrin signaling. TIMP-1 also engages in protein-protein interactions with MMP1, MMP3, MMP10, and MMP13, demonstrating its regulatory influence on these metalloproteinases. Furthermore, it forms a complex with CD63 and ITGB1, indicating its participation in intricate cellular signaling networks.

Measured by its ability to inhibit human MMP-2 cleavage of a fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The IC₅₀ value is 0.131 nM, as measured under the described conditions.

Mouse

HEK293

Tag Free

P12032 (C25-R205)

21857  [NCBI]

CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR

Approximately 26.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.