TIMP-2 Protein, Mouse (HEK293, C-His)

TIMP-2 is a tissue inhibitor of metalloproteinases that forms complexes with metalloproteinases, especially collagenases, effectively and irreversibly inactivating them by binding to their catalytic zinc cofactor.This interaction plays a crucial role in regulating the activity of metalloproteinases.TIMP-2 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Tissue inhibitor of metalloproteinases-2 (TIMP-2) is a protein that forms complexes with metalloproteinases, including collagenases, leading to the irreversible inactivation of these enzymes by binding to their catalytic zinc cofactor. Notably, TIMP-2 exhibits a specific interaction with matrix metalloproteinase 2 (MMP2) through its C-terminal region. This interaction, particularly with the C-terminal PEX domain of MMP2, results in the inhibition of MMP2 activity. TIMP-2's ability to regulate metalloproteinases underscores its significance in controlling extracellular matrix remodeling, with implications for various physiological and pathological processes. (

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ this effect is 34.88 ng/mL, corresponding to a specific activity is 2.87×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ this effect is 34.88 ng/mL, corresponding to a specific activity is 2.87×10⁴ units/mg.

Mouse

HEK293

C-6*His

P25785 (C27-P220)

21858  [NCBI]

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Approximately 21.41 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.