Tissue Factor Protein, Mouse (HEK293, His)

Tissue factor (TF) initiates blood coagulation by forming a complex with circulating factor VII or VIIa, thus forming the [TF:VIIa] complex. This complex is capable of specific limited proteolysis of factors IX or X and plays a key role in normal hemostasis by initiating the coagulation protease cascade. Tissue Factor Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tissue Factor protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Tissue Factor Protein, Mouse (HEK293, His) is 223 a.a., with molecular weight of 35-42 kDa.

Tissue Factor (TF) serves as a crucial initiator of blood coagulation through its formation of a complex with circulating factor VII or VIIa. The resulting [TF:VIIa] complex facilitates the specific limited proteolysis of factors IX or X, thereby playing a pivotal role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade. Notably, TF's interaction with HSPE is significant, with heparin acting as an inhibitor; this interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, underscoring TF's intricate involvement in the regulation of blood clotting processes.

Mouse

HEK293

C-6*His

P20352 (A29-E251)

14066  [NCBI]

AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE

35-42 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 0.05% Brij35, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.