TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His)

TMEFF2/Tomoregulin-2 protein serves as a potential survival factor for hippocampal and midbrain neurons, supporting neuronal cell viability.In addition, its shed form may upregulate cancer cell proliferation by promoting ERK1/2 phosphorylation.TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His) is the recombinant human-derived TMEFF2/Tomoregulin-2 protein, expressed by HEK293 , with C-10*His labeled tag.

TMEFF2/Tomoregulin-2 Protein emerges as a potential survival factor for hippocampal and mesencephalic neurons, indicating its role in supporting the viability of neural cells. In addition to its neuroprotective function, the shedded form of TMEFF2/Tomoregulin-2 is implicated in up-regulating cancer cell proliferation, potentially by facilitating ERK1/2 phosphorylation. This dual role suggests a complex involvement in both neuronal survival and cancer cell proliferation, highlighting the versatility of TMEFF2 in diverse cellular contexts. Further exploration of the mechanisms underlying TMEFF2's impact on neuronal and cancer cell functions could provide valuable insights into its specific roles and potential therapeutic implications in neural and cancer biology.

Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody, the EC₅₀ is ≤7 ng/mL.

Human

HEK293

C-10*His

Q9UIK5 (F41-V320)

23671  [NCBI]

FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV

47 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.