1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. TMX1 Protein, Human (HEK293, Fc)

TMX1 Protein is a member of the protein disulfide isomerase (PDI) family and is a transmembrane thiol isomerase. TMX1 Protein can participate in various redox reactions, reversibly oxidizes to disulfide through its active center thiol, and catalyzes the thiol-disulfide exchange reaction. In addition, TMX1 Protein negatively regulates the activation of αibβ3 integrin and platelet aggregation outside the cell. TMX1 Protein, Human (HEK293, Fc) is the recombinant human-derived TMX1 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of TMX1 Protein, Human (HEK293, Fc) is 154 a.a., with molecular weight of 45-50 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TMX1 Protein is a member of the protein disulfide isomerase (PDI) family and is a transmembrane thiol isomerase. TMX1 Protein can participate in various redox reactions, reversibly oxidizes to disulfide through its active center thiol, and catalyzes the thiol-disulfide exchange reaction. In addition, TMX1 Protein negatively regulates the activation of αibβ3 integrin and platelet aggregation outside the cell. TMX1 Protein, Human (HEK293, Fc) is the recombinant human-derived TMX1 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of TMX1 Protein, Human (HEK293, Fc) is 154 a.a., with molecular weight of 45-50 kDa.

Background

TMX1 Protein can participate in various oxidation-reduction reactions, both oxidizing and reducing disulfide bonds, and selectively acting on membrane-associated polypeptides[1].
As a thiol tumor suppressor, TMX1 Protein can increase mitochondrial ATP production and apoptosis progression. Under oxidative conditions, TMX1 Protein interacts with SERCA2b in a thiol-dependent manner, thereby reducing SERCA activity and reducing endoplasmic reticulum Ca2+ load[2].
The extracellular TMX1 protein has a negative regulatory effect on the activation of αibβ3 integrin and platelet aggregation[3].

Species

Human

Source

HEK293

Tag

C-mFc

Accession

AAH36460 (R27-S180)

Gene ID
Molecular Construction
N-term
TMX1 (R27-S180)
Accession # AAH36460
mFc
C-term
Synonyms
Thioredoxin-related transmembrane protein 1; TMX; TXNDC; TXNDC1
AA Sequence

RRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGS

Molecular Weight

Approximately 45-50 kDa due to the glycosylation.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TMX1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMX1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76681
Quantity:
MCE Japan Authorized Agent: