TNC Protein, Human (His)

TNC proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. TNC Protein, Human (His) is the recombinant human-derived TNC protein, expressed by E. coli , with N-6*His labeled tag.

The TNC protein, an extracellular matrix protein, plays a crucial role in guiding migrating neurons and axons during development, contributing to processes such as synaptic plasticity and neuronal regeneration. It facilitates neurite outgrowth from cortical neurons grown on a monolayer of astrocytes, indicative of its involvement in the intricate cellular interactions within the nervous system. Acting as a ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3, and alpha-V/beta-6, TNC establishes molecular connections essential for cellular communication and signaling. In the context of tumors, TNC stimulates angiogenesis by promoting the elongation, migration, and sprouting of endothelial cells. Structurally, TNC exists as a homohexamer, with a potential homotrimer formation in the triple coiled-coil region, further stabilized by disulfide rings at both ends. This versatile protein also interacts with CSPG4, indicating its involvement in diverse cellular and molecular processes across different biological contexts.

Measured by the ability of the immobilized protein to block Fibronectin-mediated adhesion of NIH-3T3 mouse embryonic fibroblast cells. rhTenascin-C immobilized at 15 μg/mL, in the presence of 0.1 μg/mL human Fibronectin, will block approximately 54.61% NIH3/T3 cell adhesion (5x10⁴ cells/well, 100 μL/well)

Human

E. coli

N-6*His

P24821-1 (D1888-A2201)

3371  [NCBI]

DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

Approximately 36-39.5 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.