1. Recombinant Proteins
  2. Others
  3. TNFAIP8 Protein, Human (His)

TNFAIP8 Protein functions as a negative regulator of apoptosis, inhibiting caspase-8 activity and suppressing TNF-mediated apoptosis without affecting procaspase-8 processing.This control prevents BID cleavage and subsequent caspase-3 activation, contributing to cellular survival mechanisms.TNFAIP8's role highlights its potential significance in apoptosis regulation and its implications for tumor development.TNFAIP8 Protein, Human (His) is the recombinant human-derived TNFAIP8 protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNFAIP8 Protein functions as a negative regulator of apoptosis, inhibiting caspase-8 activity and suppressing TNF-mediated apoptosis without affecting procaspase-8 processing.This control prevents BID cleavage and subsequent caspase-3 activation, contributing to cellular survival mechanisms.TNFAIP8's role highlights its potential significance in apoptosis regulation and its implications for tumor development.TNFAIP8 Protein, Human (His) is the recombinant human-derived TNFAIP8 protein, expressed by E.coli , with N-His labeled tag.

Background

TNFAIP8 Protein serves as a negative regulator of apoptosis and is implicated in tumor progression. Its functional role involves the suppression of TNF-mediated apoptosis through the inhibition of caspase-8 activity, while not affecting the processing of procaspase-8. This, in turn, leads to the prevention of BID cleavage and the subsequent activation of caspase-3. By exerting control over key components in the apoptotic pathway, TNFAIP8 contributes to cellular survival mechanisms, emphasizing its potential significance in the context of apoptosis regulation and its implications for tumor development.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O95379-1 (M1-I198)

Gene ID
Molecular Construction
N-term
His
TNFAIP8 (M1-I198)
Accession # O95379
C-term
Synonyms
Tumor necrosis factor alpha-induced protein 8; MDC-3.13; NDED; SCC-S2; TNF-induced protein GG2-1
AA Sequence

MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

Molecular Weight

Approximately 24 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.0, 10% Glycerol, 10% trehalose, 0.02% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TNFAIP8 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFAIP8 Protein, Human (His)
Cat. No.:
HY-P76682
Quantity:
MCE Japan Authorized Agent: