TNFRSF12A Protein, Mouse (HEK293, Fc)

TNFRSF12A Protein, a receptor for TNFSF12/TWEAK, exhibits a weak apoptosis-inducing ability in specific cells.It promotes angiogenesis and endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins.In functional interactions, TNFRSF12A associates with TRAF1 and TRAF2, possibly with TRAF3, suggesting its involvement in signaling pathways contributing to diverse cellular processes.TNFRSF12A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TNFRSF12A protein, expressed by HEK293 , with C-hFc labeled tag.

The TNFRSF12A protein acts as a receptor for TNFSF12/TWEAK, with a weak ability to induce apoptosis in certain cell types. Additionally, it plays a role in promoting angiogenesis and stimulating the proliferation of endothelial cells. TNFRSF12A may also modulate cellular adhesion to matrix proteins. In its functional interactions, TNFRSF12A associates with TRAF1 and TRAF2, and possibly with TRAF3, indicating its involvement in signaling pathways that contribute to various cellular processes.

Mouse

HEK293

C-hFc

Q9CR75 (E28-W79)

27279  [NCBI]

EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW

30-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.