Troponin C/TNNC1 Protein, Human (His)

Troponin C, represented by the TNNC1 gene, centrally regulates striated muscle contraction. In the troponin complex consisting of Tn-I, Tn-T, and Tn-C, Tn-I inhibits the actomyosin ATPase, while Tn-T binds to tropomyosin. Troponin C/TNNC1 Protein, Human (His) is the recombinant human-derived Troponin C/TNNC1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Troponin C/TNNC1 Protein, Human (His) is 161 a.a., with molecular weight of 17-20 kDa.

Troponin C, represented by the TNNC1 gene, serves as the central regulatory protein orchestrating striated muscle contraction. The troponin complex, composed of Tn-I, Tn-T, and Tn-C, plays a pivotal role in this regulatory mechanism. Tn-I functions as the inhibitor of actomyosin ATPase, while Tn-T provides the binding site for tropomyosin. Of particular significance, Tn-C serves as the calcium-binding component, and upon calcium interaction, it nullifies the inhibitory effect of Tn-I on actin filaments. This intricate interplay highlights the pivotal role of Troponin C in translating calcium signals into the modulation of muscle contraction dynamics.

Human

E. coli

N-6*His

P63316 (M1-E161)

7134  [NCBI]

MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

17-20 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.