1. Recombinant Proteins
  2. Others
  3. TPM4 Protein, Human (HEK293, His)

The TPM4 protein binds actin filaments in muscle and non-muscle cells and critically regulates calcium-dependent muscle contraction with the help of the vertebrate troponin complex. In smooth muscle cells, TPM4 interacts with caldesmon and contributes to contraction regulation. TPM4 Protein, Human (HEK293, His) is the recombinant human-derived TPM4 protein, expressed by HEK293 , with N-His, N-6*His labeled tag. The total length of TPM4 Protein, Human (HEK293, His) is 247 a.a., with molecular weight of 35-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TPM4 protein binds actin filaments in muscle and non-muscle cells and critically regulates calcium-dependent muscle contraction with the help of the vertebrate troponin complex. In smooth muscle cells, TPM4 interacts with caldesmon and contributes to contraction regulation. TPM4 Protein, Human (HEK293, His) is the recombinant human-derived TPM4 protein, expressed by HEK293 , with N-His, N-6*His labeled tag. The total length of TPM4 Protein, Human (HEK293, His) is 247 a.a., with molecular weight of 35-40 kDa.

Background

TPM4 protein exhibits binding specificity to actin filaments in both muscle and non-muscle cells, playing a pivotal role, particularly in conjunction with the troponin complex, in the calcium-dependent regulation of striated muscle contraction in vertebrates. In smooth muscle cells, TPM4 contributes to the regulation of contraction through interaction with caldesmon. In non-muscle cells, TPM4 is implicated in stabilizing actin filaments within the cytoskeleton. Additionally, TPM4 has a calcium-binding capacity, as demonstrated in studies. It forms homodimers and heterodimers, the latter composed of an alpha chain (TPM1, TPM3, or TPM4) and a beta chain (TPM2), showcasing its versatility in molecular configurations. The multifaceted interactions of TPM4 underscore its essential roles in both muscle contraction and cytoskeletal dynamics across diverse cellular contexts.

Species

Human

Source

HEK293

Tag

N-His;N-6*His

Accession

P67936 (A2-I248)

Gene ID
Molecular Construction
N-term
His
TPM4 (A2-I248)
Accession # P67936
C-term
Synonyms
Tropomyosin alpha-4 chain; TM30p1; Tropomyosin-4; TPM4
AA Sequence

AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

Molecular Weight

35-40 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TPM4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TPM4 Protein, Human (HEK293, His)
Cat. No.:
HY-P76111
Quantity:
MCE Japan Authorized Agent: