1. Recombinant Proteins
  2. Others
  3. TPP2 Protein, Human (Myc, His)

TPP2 protein, a cytosolic tripeptidyl-peptidase, is a vital component of the ubiquitin-proteasome pathway, operating downstream of the 26S proteasome. It plays a crucial role in maintaining intracellular amino acid homeostasis by releasing N-terminal tripeptides from polypeptides. Furthermore, TPP2 protein is implicated in stimulating adipogenesis, contributing to processes involved in adipose tissue formation. TPP2 Protein, Human (Myc, His) is the recombinant human-derived TPP2 protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of TPP2 Protein, Human (Myc, His) is 221 a.a., with molecular weight of ~31.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TPP2 protein, a cytosolic tripeptidyl-peptidase, is a vital component of the ubiquitin-proteasome pathway, operating downstream of the 26S proteasome. It plays a crucial role in maintaining intracellular amino acid homeostasis by releasing N-terminal tripeptides from polypeptides. Furthermore, TPP2 protein is implicated in stimulating adipogenesis, contributing to processes involved in adipose tissue formation. TPP2 Protein, Human (Myc, His) is the recombinant human-derived TPP2 protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of TPP2 Protein, Human (Myc, His) is 221 a.a., with molecular weight of ~31.8 kDa.

Background

The cytosolic tripeptidyl-peptidase TPP2 protein functions as a key component of the proteolytic cascade in the ubiquitin-proteasome pathway, acting downstream of the 26S proteasome. It plays a crucial role in intracellular amino acid homeostasis, functioning to release N-terminal tripeptides from polypeptides. Additionally, TPP2 protein has been implicated in stimulating adipogenesis, contributing to cellular processes involved in adipose tissue formation.

Species

Human

Source

E. coli

Tag

N-His;C-Myc

Accession

P29144 (44D-264H)

Gene ID
Molecular Construction
N-term
10*His
TPP2 (44D-264H)
Accession # P29144
Myc
C-term
Synonyms
TPP2; Tripeptidyl-peptidase 2; TPP-2; EC 3.4.14.10; Tripeptidyl aminopeptidase; Tripeptidyl-peptidase II; TPP-II
AA Sequence

DTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH

Molecular Weight

Approximately 31.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TPP2 Protein, Human (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TPP2 Protein, Human (Myc, His)
Cat. No.:
HY-P71451
Quantity:
MCE Japan Authorized Agent: