TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC).It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

TRAIL R2/TNFRSF10B Protein serves as a receptor for the cytotoxic ligand TNFSF10/TRAIL. Upon ligand binding, the adapter molecule FADD recruits caspase-8 to the activated receptor, leading to the formation of the death-inducing signaling complex (DISC). The DISC performs caspase-8 proteolytic activation, initiating a cascade of caspases that mediate apoptosis. Additionally, TRAIL R2/TNFRSF10B promotes the activation of NF-kappa-B and is essential for ER stress-induced apoptosis. In its monomeric form, it can interact with TRADD and RIPK1, and three TNFRSF10B molecules interact with the TNFSF10 homotrimer. In the absence of stimulation, TRAIL R2/TNFRSF10B interacts with BIRC2, DDX3X, and GSK3B, with enhanced interactions observed upon receptor stimulation, accompanied by DDX3X and BIRC2 cleavage (By similarity).

Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED₅₀ this effect is 2-10 ng/mL in the presence of rhTRAIL, corresponding to a specific activity is 1-5×10⁵ units/mg.

• 
  Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L‑929 mouse fibroblast cells treated with TRAIL. The ED₅₀ for this effect is 9.013 ng/mL in the presence of 20 ng/mL of rhTRAIL, corresponding to a specific activity is 1.110×10⁵ units/mg.

Mouse

HEK293

C-hFc

Q9QZM4 (N53-S177)

21933  [NCBI]

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

50-75 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.