Transthyretin/TTR Protein, Cynomolgus (HEK293, His)

Transthyretin (TTR) is a thyroid hormone-binding protein that may be involved in transporting thyroxine from the blood to the brain. As a homotetramer, TTR forms a dimer of dimers with a ligand-regulated central channel. Transthyretin/TTR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Transthyretin/TTR protein, expressed by HEK293 , with N-His, N-Myc labeled tag. The total length of Transthyretin/TTR Protein, Cynomolgus (HEK293, His) is 127 a.a., with molecular weight of ~18 kDa.

Transthyretin (TTR), a thyroid hormone-binding protein, is implicated in the likely transport of thyroxine from the bloodstream to the brain. Structurally organized as a homotetramer, TTR forms a dimer of dimers, where subunits assemble around a central channel capable of accommodating two ligand molecules. The intricate architecture of the homotetramer suggests a functional role in facilitating the transport of thyroid hormones. Additionally, TTR interacts with RBP4, further highlighting its involvement in complex molecular interactions and potential roles in thyroid hormone regulation.

Measured in a cell proliferation assay using A549 cells. The ED50 this effect is 1.794 ng/mL, corresponding to a specific activity is 5.57×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using A549 cells. The ED₅₀ this effect is 1.794 ng/mL, corresponding to a specific activity is 5.57×10⁵ units/mg.

Cynomolgus

HEK293

N-His;N-Myc

Q8HXW1 (G21-E147)

101864775  [NCBI]

GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE

Approximately 18 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 20% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.