1. Recombinant Proteins
  2. Others
  3. Transthyretin/TTR Protein, Mouse (HEK293, His)

Transthyretin/TTR Protein, Mouse (HEK293, His)

Cat. No.: HY-P73580
SDS COA Handling Instructions Technical Support

The transthyretin/TTR protein is a thyroid hormone binder that may transport thyroxine from the blood to the brain.It exists as a homotetramer forming a dimer of dimers with a ligand-regulated central channel suggested to play a role in thyroxine binding and transport.Transthyretin/TTR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Transthyretin/TTR protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The transthyretin/TTR protein is a thyroid hormone binder that may transport thyroxine from the blood to the brain.It exists as a homotetramer forming a dimer of dimers with a ligand-regulated central channel suggested to play a role in thyroxine binding and transport.Transthyretin/TTR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Transthyretin/TTR protein, expressed by HEK293 , with C-10*His labeled tag.

Background

Transthyretin/TTR Protein, a thyroid hormone-binding protein, likely facilitates the transport of thyroxine from the bloodstream to the brain. Existing as a homotetramer, it forms a dimer of dimers, with subunits assembling around a central channel capable of accommodating two ligand molecules. This structural arrangement suggests a role in the binding and transport of thyroxine. Furthermore, Transthyretin/TTR Protein interacts with RBP4, indicating potential functional associations and interplay in the context of thyroid hormone regulation. The homotetrameric configuration and ligand-binding capabilities underscore the significance of Transthyretin/TTR in facilitating the transport and distribution of thyroid hormones within the body.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized recombinant human TTR-His at 10 μg/mL (100 μL/well) can bind recombinant Canine RBP4, the ED50 for this effect is 1.876 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized recombinant human TTR-His at 10 μg/ml (100 μl/well) can bind recombinant Canine RBP4,The ED50 for this effect is 1.876 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

P07309 (G21-N147)

Gene ID
Molecular Construction
N-term
TTR (G21-N147)
Accession # P07309
10*His
C-term
Synonyms
Transthyretin; ATTR; Prealbumin; TBPA; TTR; PALB
AA Sequence

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Molecular Weight

Approximately 16.4 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Transthyretin/TTR Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Transthyretin/TTR Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73580
Quantity:
MCE Japan Authorized Agent: