Transthyretin/TTR Protein, Mouse (HEK293, His)

The transthyretin/TTR protein is a thyroid hormone binder that may transport thyroxine from the blood to the brain.It exists as a homotetramer forming a dimer of dimers with a ligand-regulated central channel suggested to play a role in thyroxine binding and transport.Transthyretin/TTR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Transthyretin/TTR protein, expressed by HEK293 , with C-10*His labeled tag.

Transthyretin/TTR Protein, a thyroid hormone-binding protein, likely facilitates the transport of thyroxine from the bloodstream to the brain. Existing as a homotetramer, it forms a dimer of dimers, with subunits assembling around a central channel capable of accommodating two ligand molecules. This structural arrangement suggests a role in the binding and transport of thyroxine. Furthermore, Transthyretin/TTR Protein interacts with RBP4, indicating potential functional associations and interplay in the context of thyroid hormone regulation. The homotetrameric configuration and ligand-binding capabilities underscore the significance of Transthyretin/TTR in facilitating the transport and distribution of thyroid hormones within the body.

Measured by its binding ability in a functional ELISA. Immobilized recombinant human TTR-His at 10 μg/mL (100 μL/well) can bind recombinant Canine RBP4, the ED₅₀ for this effect is 1.876 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized recombinant human TTR-His at 10 μg/ml (100 μl/well) can bind recombinant Canine RBP4,The ED₅₀ for this effect is 1.876 μg/mL.

Mouse

HEK293

C-10*His

P07309 (G21-N147)

22139  [NCBI]

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Approximately 16.4 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.