TRAP1 Protein, Human (GST)

As a chaperone with ATPase activity, TRAP1 protein plays a crucial role in protecting mitochondrial function and polarization, especially downstream of PINK1 and mitochondrial complex I. TRAP1 acts as a negative regulator of mitochondrial respiration, affecting the balance between oxidative phosphorylation and aerobic glycolysis. TRAP1 Protein, Human (GST) is the recombinant human-derived TRAP1 protein, expressed by E. coli , with N-GST labeled tag. The total length of TRAP1 Protein, Human (GST) is 249 a.a., with molecular weight of ~54.5 kDa.

TRAP1 (TNF receptor-associated protein 1) serves as a chaperone with ATPase activity and is integral in preserving mitochondrial function and polarization, functioning downstream of PINK1 and mitochondrial complex I. It acts as a negative regulator of mitochondrial respiration, dynamically influencing the balance between oxidative phosphorylation and aerobic glycolysis. TRAP1's impact on mitochondrial respiration is likely mediated through the modulation of mitochondrial SRC and inhibition of SDHA. Furthermore, TRAP1 interacts with diverse cellular components, including binding to the intracellular domain of the tumor necrosis factor type 1 receptor, forming complexes with RB1, and engaging with SRC and SDHA. These interactions underscore the multifaceted nature of TRAP1's involvement in cellular processes (

Human

E. coli

N-GST

Q12931 (60S-308E)

10131  [NCBI]

STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE

Approximately 54.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.