TREM-1 Protein, Mouse (HEK293, His)

The TREM-1 protein is a key cell surface receptor that amplifies inflammatory responses in innate and adaptive immunity. Ligands such as PGLYRP1, HMGB1 or HSP70 activate TREM-1, leading to multimerization and complex formation with TYROBP/DAP12. TREM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TREM-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TREM-1 Protein, Mouse (HEK293, His) is 182 a.a., with molecular weight of ~38.0 kDa.

TREM-1, a cell surface receptor, assumes pivotal roles in both innate and adaptive immunity by robustly amplifying inflammatory responses. Upon activation by diverse ligands such as PGLYRP1, HMGB1, or HSP70, TREM-1 undergoes multimerization and forms a complex with the transmembrane adapter TYROBP/DAP12. This initiates a SYK-mediated cascade of tyrosine phosphorylation, activating downstream mediators like BTK, MAPK1, MAPK3, or phospholipase C-gamma. Consequently, this cascade facilitates the release of pro-inflammatory cytokines and/or chemokines by neutrophils and macrophages, promoting their migration and thereby amplifying inflammatory responses triggered by bacterial and fungal infections. Beyond microbial interactions, TREM-1 also contributes to the amplification of inflammatory signals initiated by Toll-like receptor (TLR) and NOD-like receptor engagement, playing a crucial role in the pathophysiology of various acute and chronic inflammatory diseases, including septic shock and atherosclerosis. In its monomeric state, TREM-1 forms homomultimers upon activation and interacts with TYROBP/DAP12 and TLR4, further highlighting its intricate involvement in the regulation of immune responses.

Mouse

HEK293

C-6*His

Q9JKE2 (A21-S202)

58217  [NCBI]

AIVLEEERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTKGSSDVFTPVIIPITRLTERPILITTKYSPSDTTTTRSLPKPTAVVSSPGLGVTIINGTDADSVSTSS

Approximately 38.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.