TROP-2 Protein, Mouse (246a.a, HEK293, His)

The TROP-2 protein functions as a growth factor receptor and has been shown to play a critical role in mediating cellular responses associated with growth regulation. Its involvement indicates that it plays a crucial role in signal transduction during cell growth. TROP-2 Protein, Mouse (246a.a, HEK293, His) is the recombinant mouse-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TROP-2 Protein, Mouse (246a.a, HEK293, His) is 246 a.a., with molecular weight of 38-55 kDa.

The TROP-2 protein appears to function as a growth factor receptor, suggesting a key role in mediating cellular responses associated with growth regulation. Its involvement in this capacity indicates that TROP-2 may play a crucial role in transducing signals that contribute to cellular growth processes. Further exploration of the specific signaling pathways and downstream effects mediated by TROP-2 as a growth factor receptor could provide valuable insights into its functional significance and potential implications in cellular development and homeostasis.

Mouse

HEK293

C-6*His

Q8BGV3 (Q25-G270)

56753  [NCBI]

QSNCTCPTNKMTVCDTNGPGGVCQCRAMGSQVLVDCSTLTSKCLLLKARMSARKSGRSLVMPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFQERYKLHPSFLSAVHYEEPTIQIELRQNASQKGLRDVDIADAAYYFERDIKGESLFMGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTAG

38-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.