TSC22/TSC22D1 Protein, Human (His)

TSC22D1 Protein, a positive modulator of cell death during mammary gland involution in response to TGFB3, forms a heterodimer with TSC22D4/THG1. Its interactions with histone H1-2 and GNL3 underscore TSC22D1's versatile role in molecular processes, emphasizing its potential significance in various cellular contexts. TSC22/TSC22D1 Protein, Human (His) is the recombinant human-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag. The total length of TSC22/TSC22D1 Protein, Human (His) is 144 a.a., with molecular weight of ~20 kDa.

TSC22D1, a protein integral to the regulation of cellular processes, acts as a positive modulator of cell death in response to TGFB3 during mammary gland involution. Notably, it forms a heterodimer with TSC22D4/THG1, indicating its involvement in complex interactions that contribute to cellular functions. Additionally, TSC22D1 exhibits interactions with histone H1-2 and GNL3, underlining its versatile role in molecular processes and highlighting its potential significance in various cellular contexts.

Measured by its ability to inhibit the cell growth of Hela cells. The ED₅₀ for this effect is 0.6712 μg/mL, corresponding to a specific activity is 1.489×10³ units/mg.

Human

E. coli

N-His

Q15714-2 (M1-A144)

8848  [NCBI]

MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA

Approximately 19-20 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.