TSLP R Protein, Mouse (HEK293, His)

Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for TSLP. Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway. The expression of Crlf2 usually upregulates and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL)^[1][2]. TSLP R Protein, Mouse (HEK293, His) is the recombinant mouse-derived TSLP R protein, expressed by HEK293 , with C-6*His labeled tag.

Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for thymic stromal lymphopoietin (TSLP). Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway (STAT3 and STAT5). Crlf2 usually upregulated and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL)^[1][2].

Mouse

HEK293

C-6*His

AAH23788.1 (A20-L233)

57914  [NCBI]

AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPPL

35-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.