TSTA3 Protein, Human (His)

The TSTA3 protein plays a key role in catalyzing the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. The process involves successive epimerase and reductase reactions, ultimately leading to the biosynthesis of GDP-fucose. TSTA3 Protein, Human (His) is the recombinant human-derived TSTA3 protein, expressed by E. coli , with C-6*His labeled tag. The total length of TSTA3 Protein, Human (His) is 321 a.a., with molecular weight of ~40.0 kDa.

TSTA3, also known as GDP-L-fucose synthase, is an enzyme responsible for the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. This enzymatic process involves both an epimerase and a reductase reaction. In the first step, the epimerase activity facilitates the conversion of GDP-4-dehydro-6-deoxy-D-mannose to an intermediate, and in the subsequent reductase reaction, this intermediate is further reduced to yield GDP-fucose. GDP-fucose is a critical nucleotide sugar that serves as a precursor in the biosynthesis of fucosylated glycans. Fucosylation plays pivotal roles in various biological processes, including cell adhesion, immune response, and signaling. The catalytic function of TSTA3 in the synthesis of GDP-fucose highlights its importance in the regulation of glycan structures and their involvement in diverse cellular functions.

Human

E. coli

C-6*His

Q13630 (M1-K321)

7264  [NCBI]

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK

Approximately 40.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.