1. Recombinant Proteins
  2. Others
  3. TXNDC12 Protein, Human (HEK293, His)

The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TXNDC12 Protein, Human (HEK293, His) is 142 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TXNDC12 Protein, Human (HEK293, His) is 142 a.a., with molecular weight of ~18.0 kDa.

Background

TXNDC12 protein, a crucial protein-disulfide reductase localized in the endoplasmic reticulum, plays a pivotal role in promoting the formation of disulfide bonds in client proteins by virtue of its thiol-disulfide oxidase activity. As an essential component of the cellular machinery, TXNDC12 contributes to the intricate processes of protein folding and maturation within the endoplasmic reticulum. Its catalytic function in facilitating disulfide bond formation underscores its significance in maintaining proper protein structure and function, reflecting its central role in cellular homeostasis and the quality control mechanisms of protein processing in the endoplasmic reticulum.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O95881 (H27-L168)

Gene ID
Molecular Construction
N-term
TXNDC12 (H27-L168)
Accession # O95881
6*His
C-term
Synonyms
Thioredoxin Domain-Containing Protein 12; Endoplasmic Reticulum Resident Protein 18; ER Protein 18; ERp18; Endoplasmic Reticulum Resident Protein 19; ER Protein 19; ERp19; Thioredoxin-Like Protein p19; hTLP19; TXNDC12; TLP19
AA Sequence

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TXNDC12 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TXNDC12 Protein, Human (HEK293, His)
Cat. No.:
HY-P71046
Quantity:
MCE Japan Authorized Agent: