TXNDC12 Protein, Human (HEK293, His)

The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TXNDC12 Protein, Human (HEK293, His) is 142 a.a., with molecular weight of ~18.0 kDa.

TXNDC12 protein, a crucial protein-disulfide reductase localized in the endoplasmic reticulum, plays a pivotal role in promoting the formation of disulfide bonds in client proteins by virtue of its thiol-disulfide oxidase activity. As an essential component of the cellular machinery, TXNDC12 contributes to the intricate processes of protein folding and maturation within the endoplasmic reticulum. Its catalytic function in facilitating disulfide bond formation underscores its significance in maintaining proper protein structure and function, reflecting its central role in cellular homeostasis and the quality control mechanisms of protein processing in the endoplasmic reticulum.

Human

HEK293

C-6*His

O95881 (H27-L168)

51060  [NCBI]

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL

Approximately 18.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.