TXNDC17 Protein, Human

TXNDC17 Protein is a novel 14-kDa disul-fide reductase of the TXN (thioredoxin) family. It has peroxidase activity and protein-disulfide reductase (NAD(P)) activity. TXNDC17 is involved in the TNF (tumor necrosis factor) signaling pathway. And it inhibits the pathways of NF-κB, mitogen-activated protein kinases, and apoptosis in cells stimulated with TNF-alpha. Furthermore, TXNDC17 is an efficient S-denitrosylase. TXNDC17 Protein, Human is the recombinant human-derived TXNDC17 protein, expressed by E. coli , with tag free. The total length of TXNDC17 Protein, Human is 123 a.a., with molecular weight of ~13.9 kDa.

Thioredoxin domain-containing protein 17 (TXNDC17) is a novel 14-kDa disul-fide reductase of the TXN (thioredoxin) family. It has peroxidase activity and protein-disulfide reductase (NAD(P)) activity. TXNDC17 is involved in the TNF (tumor necrosis factor) signaling pathway. TXNDC17 inhibits the pathways of nuclear factor-kappaB (NF-kappaB), mitogen-activated protein kinases, and apoptosis in cells stimulated with tumor necrosis factor-alpha (TNF-alpha). In addition, TXNDC17 is an efficient S-denitrosylase with similar efficiency as Trx1 in catalyzing TrxR1-dependent denitrosylation of S-nitrosylated glutathione or of HEK293 cell-derived S-nitrosoproteins^[1][2].

Human

E. coli

Tag Free

A0A140VJY7 (M1-D123)

84817  [NCBI]

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED

Approximately 13.9 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.