1. Recombinant Proteins
  2. Others
  3. TXNDC4 Protein, Human (HEK293, His)

The TXNDC4 protein is critical in cellular processes, mediating thiol-dependent retention in the early secretory pathway.Its conserved CRFS motif forms mixed disulfide bonds with substrate proteins to control oxidative protein folding in the endoplasmic reticulum and maintain cellular redox balance.TXNDC4 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC4 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TXNDC4 protein is critical in cellular processes, mediating thiol-dependent retention in the early secretory pathway.Its conserved CRFS motif forms mixed disulfide bonds with substrate proteins to control oxidative protein folding in the endoplasmic reticulum and maintain cellular redox balance.TXNDC4 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC4 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TXNDC4 Protein plays a pivotal role in cellular processes by mediating thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. This interaction is integral to the control of oxidative protein folding in the endoplasmic reticulum, highlighting TXNDC4's involvement in maintaining cellular redox balance. Notably, the protein inhibits the calcium channel activity of ITPR1 and is required for the retention of ERO1A and ERO1B in the endoplasmic reticulum. TXNDC4 forms mixed disulfides with both ERO1A and ERO1B, as well as cargo folding intermediates, contributing to their retention in the endoplasmic reticulum. Furthermore, the direct interaction with ITPR1 occurs in a pH-, redox state-, and calcium-dependent manner, with the strength of this interaction inversely correlating with calcium concentration. The multifaceted role of TXNDC4 underscores its significance in cellular homeostasis, particularly in regulating protein folding and redox dynamics within the secretory pathway.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9BS26 (E30-D402)

Gene ID
Molecular Construction
N-term
TXNDC4 (E30-D402)
Accession # Q9BS26
6*His
C-term
Synonyms
Thioredoxin domain-containing protein 4; ER protein 44; KIAA0573; TXNDC4
AA Sequence

EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRD

Molecular Weight

Approximately 50.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TXNDC4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TXNDC4 Protein, Human (HEK293, His)
Cat. No.:
HY-P70901
Quantity:
MCE Japan Authorized Agent: