TXNL4B Protein, Human (His)

TXNL4B Protein, vital for pre-mRNA splicing, is crucial for S/G(2) cell cycle transition, forming homodimers and interacting with the U5-102 kDa spliceosome subunit. It plays a key role in splicing intricacies and influences cell cycle dynamics. TXNL4B Protein, Human (His) is the recombinant human-derived TXNL4B protein, expressed by E. coli , with N-His labeled tag. The total length of TXNL4B Protein, Human (His) is 149 a.a., with molecular weight of ~19 kDa.

TXNL4B Protein plays an essential role in pre-mRNA splicing, serving as a crucial component required for proper cell cycle progression during the S/G(2) transition. Forming homodimers, TXNL4B interacts with the U5-102 kDa protein subunit of the spliceosome, highlighting its integral involvement in the intricate process of splicing and its impact on cell cycle dynamics.

Human

E. coli

N-His

Q9NX01 (M1-I149)

54957  [NCBI]

MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

Approximately 19 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, 20% glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.