UBASH3B/STS1 Protein, Human (His)

UBASH3B/STS1 protein blocks CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases, leading to the accumulation of activating receptors such as T cell receptors and EGFR on the cell surface. It exhibits tyrosine phosphatase activity against substrates such as EGFR, FAK, SYK and ZAP70. UBASH3B/STS1 Protein, Human (His) is the recombinant human-derived UBASH3B/STS1 protein, expressed by E. coli , with N-His, N-6*His labeled tag. The total length of UBASH3B/STS1 Protein, Human (His) is 268 a.a., with molecular weight of ~30 kDa.

UBASH3B/STS1 protein disrupts the CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases, leading to the accumulation of activated target receptors, such as T-cell receptors and EGFR, on the cell surface. Additionally, it demonstrates tyrosine phosphatase activity towards multiple substrates, including EGFR, FAK, SYK, and ZAP70. Furthermore, UBASH3B/STS1 participates in the down-regulation of proteins that undergo dual modification involving both protein tyrosine phosphorylation and ubiquitination.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-His;N-6*His

Q8TF42 (Q382-E649)

84959  [NCBI]

QKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE

Approximately 30 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 6.8.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.