1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. UBE2D2
  6. UbcH5b/UBE2D2 Protein, Human

The UbcH5b/UBE2D2 protein is an important cellular mediator that accepts ubiquitin from the E1 complex and catalyzes multifunctional “Lys-48”-linked polyubiquitination on target proteins. In addition to its catalytic role, it also concentrates and selectively degrades short-lived proteins and contributes to E6/E6-AP-induced ubiquitination of p53/TP53. UbcH5b/UBE2D2 Protein, Human is the recombinant human-derived UbcH5b/UBE2D2 protein, expressed by E. coli , with tag free. The total length of UbcH5b/UBE2D2 Protein, Human is 147 a.a., with molecular weight of ~16 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UbcH5b/UBE2D2 protein is an important cellular mediator that accepts ubiquitin from the E1 complex and catalyzes multifunctional “Lys-48”-linked polyubiquitination on target proteins. In addition to its catalytic role, it also concentrates and selectively degrades short-lived proteins and contributes to E6/E6-AP-induced ubiquitination of p53/TP53. UbcH5b/UBE2D2 Protein, Human is the recombinant human-derived UbcH5b/UBE2D2 protein, expressed by E. coli , with tag free. The total length of UbcH5b/UBE2D2 Protein, Human is 147 a.a., with molecular weight of ~16 kDa.

Background

The UbcH5b/UBE2D2 protein serves as a crucial mediator in cellular processes, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to various proteins. With a pronounced preference for 'Lys-48'-linked polyubiquitination, UbcH5b/UBE2D2 demonstrates its versatility in modifying target proteins. Beyond its catalytic role, it plays a central part in the selective degradation of short-lived and aberrant proteins. UbcH5b/UBE2D2 is instrumental in the E6/E6-AP-induced ubiquitination of p53/TP53 and is involved in the ubiquitination of PEX5, as well as the autoubiquitination of STUB1 and TRAF6. Its engagement extends to signal-induced processes, including the conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53, and the activation of MAVS in the mitochondria by RIGI in response to viral infection. Moreover, UbcH5b/UBE2D2 proves to be essential for the viral activation of IRF3.

Biological Activity

Recombinant Human UbcH5b/UBE2D2 is a member of the Ubiquitin-conjugating (E2) enzyme family that receives Ubiquitin from a Ubiquitin-activating (E1) enzyme and subsequently interacts with a Ubiquitin ligase (E3) to conjugate Ubiquitin to substrate proteins.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P62837-1 (M1-M147)

Gene ID
Molecular Construction
N-term
UbcH5b (M1-M147)
Accession # P62837
C-term
Synonyms
Ubiquitin-conjugating enzyme E2 D2; UBE2D2; (E3-independent) E2 ubiquitin-conjugating enzyme D2 (EC:2.3.2.24); E2 ubiquitin-conjugating enzyme D2; Ubiquitin carrier protein D2; Ubiquitin-conjugating enzyme E2(17)KB 2; Ubiquitin-conjugating enzyme E2-17 kD
AA Sequence

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM

Molecular Weight

Approximately 16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 50 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

UbcH5b/UBE2D2 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UbcH5b/UBE2D2 Protein, Human
Cat. No.:
HY-P79449
Quantity:
MCE Japan Authorized Agent: