1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin Conjugating Enzyme E2 J2
  6. UBE2J2 Protein, Human (GST)

The UBE2J2 protein plays a crucial role in cellular processes by catalyzing the covalent attachment of ubiquitin to other proteins. Its function is involved in the selective degradation of misfolded membrane proteins extending into the endoplasmic reticulum (ERAD), as suggested by the similarity of related processes. UBE2J2 Protein, Human (GST) is the recombinant human-derived UBE2J2 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UBE2J2 protein plays a crucial role in cellular processes by catalyzing the covalent attachment of ubiquitin to other proteins. Its function is involved in the selective degradation of misfolded membrane proteins extending into the endoplasmic reticulum (ERAD), as suggested by the similarity of related processes. UBE2J2 Protein, Human (GST) is the recombinant human-derived UBE2J2 protein, expressed by E. coli , with N-GST labeled tag.

Background

UBE2J2, or ubiquitin-conjugating enzyme E2 J2, is a protein that plays a central role in the covalent attachment of ubiquitin to other proteins, a process critical for the regulation of protein stability and degradation. UBE2J2 is suggested to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD), indicating its involvement in cellular quality control mechanisms. Additionally, in cooperation with the GATOR2 complex, UBE2J2 catalyzes 'Lys-6'-linked ubiquitination of NPRL2, suggesting its participation in the regulation of cellular processes through ubiquitin modification. It has to highlight UBE2J2's dual role in ERAD and the ubiquitination of specific targets, illustrating its versatility in participating in diverse cellular pathways.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q8N2K1-1 (E124-R224)

Gene ID
Molecular Construction
N-term
GST
UBE2J2 (E124-R224)
Accession # Q8N2K1-1
C-term
Synonyms
Ubiquitin-Conjugating Enzyme E2 J2; Non-Canonical Ubiquitin-Conjugating Enzyme 2; NCUBE-2; UBE2J2; NCUBE2
AA Sequence

EKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANR

Molecular Weight

30&36 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2J2 Protein, Human (GST)
Cat. No.:
HY-P71404
Quantity:
MCE Japan Authorized Agent: