UBE2Z Protein, Human (His)

UBE2Z Protein, a catalyst in ubiquitin conjugation, facilitates the covalent attachment of ubiquitin to target proteins. It serves as a specific substrate for UBA6 and is implicated in the regulation of apoptosis. UBE2Z Protein, Human (His) is the recombinant human-derived UBE2Z protein, expressed by E. coli , with N-6*His labeled tag. The total length of UBE2Z Protein, Human (His) is 246 a.a., with molecular weight of ~32.0 kDa.

UBE2Z protein serves as an enzyme that catalyzes the covalent attachment of ubiquitin to other proteins, operating as a substrate specifically for UBA6 and not charged with ubiquitin by UBE1. This implies its involvement in the intricate process of apoptosis regulation, underscoring its role in the ubiquitin-mediated modification of target proteins.

Human

E. coli

N-6*His

Q9H832-2 (M1-V246)

65264  [NCBI]

MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV

Approximately 32.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.