1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin-Conjugating Enzyme E2 Z
  6. UBE2Z Protein, Human (His)

UBE2Z Protein, a catalyst in ubiquitin conjugation, facilitates the covalent attachment of ubiquitin to target proteins. It serves as a specific substrate for UBA6 and is implicated in the regulation of apoptosis. UBE2Z Protein, Human (His) is the recombinant human-derived UBE2Z protein, expressed by E. coli , with N-6*His labeled tag. The total length of UBE2Z Protein, Human (His) is 246 a.a., with molecular weight of ~32.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UBE2Z Protein, a catalyst in ubiquitin conjugation, facilitates the covalent attachment of ubiquitin to target proteins. It serves as a specific substrate for UBA6 and is implicated in the regulation of apoptosis. UBE2Z Protein, Human (His) is the recombinant human-derived UBE2Z protein, expressed by E. coli , with N-6*His labeled tag. The total length of UBE2Z Protein, Human (His) is 246 a.a., with molecular weight of ~32.0 kDa.

Background

UBE2Z protein serves as an enzyme that catalyzes the covalent attachment of ubiquitin to other proteins, operating as a substrate specifically for UBA6 and not charged with ubiquitin by UBE1. This implies its involvement in the intricate process of apoptosis regulation, underscoring its role in the ubiquitin-mediated modification of target proteins.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9H832-2 (M1-V246)

Gene ID
Molecular Construction
N-term
6*His
UBE2Z (M1-V246)
Accession # Q9H832-2
C-term
Synonyms
Ubiquitin-Conjugating Enzyme E2 Z; Uba6-Specific E2 Conjugating Enzyme 1; Use1; Ubiquitin Carrier Protein Z; Ubiquitin-Protein Ligase Z; UBE2Z; HOYS7
AA Sequence

MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV

Molecular Weight

Approximately 32.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2Z Protein, Human (His)
Cat. No.:
HY-P71412
Quantity:
MCE Japan Authorized Agent: