ULBP1/RAET1I Protein, Mouse (HEK293, His)

UL16 binding protein 1 (Ulbp1) is a membrane ligand of natural killer group 2, member D (NKG2D) which activates immune system on NK cells and T cells. Binding of Ulbp1 to NKG2D leads to activation of JAK2, STAT5, ERK and PI3K/Akt pathways, positive regulating immune response, interferon-gamma production and leukocyte activation. The effect of Ulbp1 can be inhibited by binding to UL16. ULBP1/RAET1I Protein, Mouse (HEK293, His) is the recombinant mouse-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ULBP1/RAET1I Protein, Mouse (HEK293, His) is 186 a.a., with molecular weight of 30-40 kDa.

UL16 binding protein 1 (Ulbp1) is a membrane ligand of natural killer group 2, member D (NKG2D), an immune system-activating receptor on NK cells and T-cells. Binding of Ulbp1 to NKG2D leads to activation of several signal transduction pathways, including those of JAK2, STAT5, ERK and PI3K/Akt. Ulbp1 is involved in positive regulation of immune response, interferon-gamma production and leukocyte activation. Also, in cytomegalovirus-infected cells, Ulbp1 binds the UL16 glycoprotein and is prevented from activating the immune system^[1][2].

Mouse

HEK293

C-6*His

Q8HWA3 (P26-T211)

77777  [NCBI]

PRIEETASLCNIYKVNRSESGQHSHEVQGLLNRQPLFVYKDKKCHAIGAHRNSMNATKICEKEVDTLKDGIDIFKGLLLHIVQETNTTGKPLTLQAEVCGQYEVDKHFTGYAIVSLNGKNIFRVDTSTGNWTQLDHEFEKFIEMCKEDKVLAAFLKKTTEGDCRTWLDELMLHWKEHLEPAGSFST

30-40 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.