UNC5B Protein, Rat (HEK293, Fc)

UNC5B is a netrin-1-dependent receptor. It negatively regulates vascular branching during angiogenesis. In addition, UNC5B protects myelin and partially alleviates injury-induced neuropathic pain (NP). UNC5B is involved in the guidance of axons and the positive regulation of exogenous apoptosis signaling pathways without binding to netrin-1. UNC5B Protein, Rat (HEK293, Fc) is the recombinant rat-derived UNC5B protein, expressed by HEK293 , with C-hFc labeled tag.

UNC5B promotes autophagic flux in Schwann cells (SCs) through phosphorylation of AMPK and ULK1, depending on its ligand netrin-1, protecting myelin and partially preventing injury-induced neuropathic pain (NP)^[1].
UNC5B also plays a role in axon guidance and positively regulates exogenous apoptosis signaling pathways without binding to netrin-1^[2].
The activation of UNC5B inhibits sprouting angiogenesis, making it a potential anti-angiogenic target^[3].

Measured by its binding ability in a functional ELISA. Immobilized UNC5B at 5 µg/mL (100 µL/well) can bind rmNetrin-1. The ED₅₀ for this effect is 218.2 ng/mL

Rat

HEK293

C-hFc

O08722/NP_071543.1 (G27-D373)

60630  [NCBI]

GIDSGGQALPDSFPSAPAEQLPHFLLEPEDAYIVKNKPVELHCRAFPATQIYFKCNGEWVSQKGHVTQESLDEATGLRIREVQIEVSRQQVEELFGLEDYWCQCVAWSSSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQACQKTACTTVCPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVLNQRTLNDPKSRPLEPSGD

Approximately 90 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.