uPAR Protein, Human (GST)

The uPAR protein is a receptor for urokinase plasminogen activator and actively localizes and promotes plasmin formation. It mediates proteolysis-independent signaling activated by U-PA and undergoes negative feedback regulation. uPAR Protein, Human (GST) is the recombinant human-derived uPAR protein, expressed by E. coli , with N-GST labeled tag.

uPAR Protein functions as a receptor for urokinase plasminogen activator, actively participating in the localization and facilitation of plasmin formation. Additionally, it serves as a mediator of the proteolysis-independent signal transduction activation effects induced by U-PA. Subject to negative-feedback regulation by U-PA, uPAR Protein undergoes cleavage into an inactive form. Typically existing as a monomer, it interacts with various proteins, including MRC2, SRPX2 (via the UPAR/Ly6 domains), and FAP (seprase), with the latter interaction occurring at the cell surface of invadopodia membrane. Moreover, uPAR Protein engages in an interaction with SORL1, specifically through the N-terminal ectodomain, and this interaction has been associated with a decrease in PLAUR internalization. Notably, the formation of a ternary complex composed of PLAUR, PLAU (urokinase-type plasminogen activator), and SERPINE1 also involves an interaction with SORL1.

Human

E. coli

N-GST

Q03405 (L23-G305)

5329

LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG

58.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.