uPAR Protein, Mouse (HEK293, His-Fc)

uPAR (urokinase plasminogen activator receptor) possesses enzyme, protein, and receptor binding activities.It regulates apoptotic signaling, epidermal growth factor signaling, and cytochrome c release.uPAR is widely expressed in structures like decidua and spleen.Its human ortholog, PLAUR, is linked to rheumatoid arthritis.Investigating uPAR can reveal its role in cellular processes and shed light on diseases like rheumatoid arthritis.uPAR Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

uPAR (urokinase plasminogen activator receptor), a multifaceted protein, is predicted to possess enzyme binding activity, protein domain-specific binding activity, and signaling receptor binding activity. It is anticipated to play a role in various processes, including the negative regulation of the apoptotic signaling pathway, positive regulation of the epidermal growth factor receptor signaling pathway, and positive regulation of the release of cytochrome c from mitochondria. As an integral component of the plasma membrane, uPAR exhibits broad expression in diverse structures such as decidua, early conceptus, and spleen. The human ortholog of this gene, PLAUR (plasminogen activator, urokinase receptor), has implications in conditions like rheumatoid arthritis, highlighting the potential significance of uPAR in physiological and pathological contexts. Studies on uPAR may unveil its intricate involvement in cellular processes and contribute to our understanding of diseases like rheumatoid arthritis.

Immobilized Recombinant rmuPAR/Fc at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant rhuPA Protein. The ED₅₀ for this effect is <50.73 ng/mL.

• 
  Immobilized Recombinant rmuPAR/Fc at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant rhuPA Protein. The ED₅₀ for this effect is 50.73 ng/mL.

Mouse

HEK293

C-hFc;C-His

NP_035243.1 (L24-T297)

18793  [NCBI]

LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT

80-90 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.