UPP1 Protein, Human (His)

UPP1 protein is a key member of the PNP/UDP phosphorylase family and plays an important role in cellular processes, especially nucleotide metabolism. UPP1 shares conserved features with related proteins and is involved in phosphorylase activity. UPP1 Protein, Human (His) is the recombinant human-derived UPP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of UPP1 Protein, Human (His) is 173 a.a., with molecular weight of ~21 kDa.

The UPP1 Protein is a vital member of the PNP/UDP phosphorylase family, highlighting its essential role in cellular processes. As part of this enzyme family, UPP1 likely shares conserved structural and functional features with related proteins, signifying its involvement in phosphorylase activities. The classification within the PNP/UDP phosphorylase family underscores its specific designation within the broader context of phosphorylases, providing insights into its unique enzymatic functions. The study of UPP1 contributes to our understanding of its role in cellular processes related to nucleotide metabolism, offering potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in phosphorylation. Further exploration of UPP1's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

Human

E. coli

N-6*His

Q86Y75 (M1-A173)

7378  [NCBI]

MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA

Approximately 21 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 1 mM DTT, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.