1. Recombinant Proteins
  2. Others
  3. UQCRH Protein, Human (GST)

UQCRH Protein, Human (GST)

Cat. No.: HY-P71088
SDS COA Handling Instructions

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag. The total length of UQCRH Protein, Human (GST) is 91 a.a., with molecular weight of 33-45 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag. The total length of UQCRH Protein, Human (GST) is 91 a.a., with molecular weight of 33-45 kDa.

Background

UQCRH, a vital constituent of the ubiquinol-cytochrome c oxidoreductase, is a key component of the mitochondrial electron transport chain essential for oxidative phosphorylation. As part of the respiratory chain, which includes succinate dehydrogenase (complex II), ubiquinol-cytochrome c oxidoreductase (complex III), and cytochrome c oxidase (complex IV), UQCRH collaborates in transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient across the inner membrane to drive ATP synthase and transmembrane transport. Operating within the cytochrome b-c1 complex, UQCRH catalyzes the transfer of electrons from ubiquinol to cytochrome c, coupling this redox reaction with the translocation of protons across the mitochondrial inner membrane. In the Q cycle process, protons are consumed from the matrix, released into the intermembrane space, and electrons are passed to cytochrome c. UQCRH is a component of the multisubunit ubiquinol-cytochrome c oxidoreductase complex, comprised of various subunits, including respiratory and core proteins, forming obligatory dimers and supercomplexes in the inner mitochondrial membrane with other respiratory complexes like NADH-ubiquinone oxidoreductase (complex I) and cytochrome c oxidase (complex IV).

Species

Human

Source

E. coli

Tag

N-GST

Accession

P07919 (M1-K91)

Gene ID
Molecular Construction
N-term
GST
UQCRH (M1-K91)
Accession # P07919
C-term
Synonyms
Cytochrome b-c1 complex subunit 6; mitochondrial; Complex III subunit 6; Complex III subunit VIII; Cytochrome c1 non-heme 11 kDa protein; Mitochondrial hinge protein; Ubiquinol-cytochrome c reductase complex 11 kDa protein
AA Sequence

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Weight

33-45 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

UQCRH Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UQCRH Protein, Human (GST)
Cat. No.:
HY-P71088
Quantity:
MCE Japan Authorized Agent: