VEGF-D Protein, Human (HEK293)

VEGF-D Protein, Human (HEK293) is a regulator of both angiogenesis and lymphangiogenesis.

VEGF-D, a powerful lymphangiogenic and angiogenic growth factor, is also a major regulator of chylomicron metabolism in mice^[1]. Vascular endothelial growth factor D (VEGF-D) has important functions in lymphangiogenesis and angiogenesis. High plasma levels of VEGF-D have been associated with incidence of heart failure. The association of VEGF-D with atrial fibrillation (AF) and stroke is unclear and we hypothesised that VEGF-D could also be associated with incidence of AF and ischaemic stroke^[2].

The ED₅₀ is <1 μg/mL as measured by HUVEC cells.

Human

CHO

Tag Free

O43915 (F89-R205)

2277  [NCBI]

FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR

Homodimer. 18-19 kDa on SDS-PAGE under reducing conditions

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Tirronen A, et al. Deletion of Lymphangiogenic and Angiogenic Growth Factor VEGF-D Leads to Severe Hyperlipidemia and Delayed Clearance of Chylomicron Remnants. 2018 Oct;38(10):2327-2337.  [Content Brief]

  [2]. Berntsson J1, et al. Increased vascular endothelial growth factor D is associated with atrial fibrillation and ischaemic stroke. Heart. 2018 Oct 16. pii: heartjnl-2018-313684.  [Content Brief]