Vitamin D-binding protein/GC Protein, Human (HEK293, His)

GC protein is a multifunctional protein that promotes vitamin D transport and storage while scavenging extracellular G-actin to maintain cellular homeostasis. It enhances the chemotactic activity of C5 alpha toward neutrophils during inflammation, helps macrophage activation, and interacts with B lymphocyte and T lymphocyte membranes, indicating its involvement in the immune process. Vitamin D-binding protein/GC Protein, Human (HEK293, His) is the recombinant human-derived Vitamin D-binding protein/GC protein, expressed by HEK293 , with C-6*His labeled tag.

Vitamin D-binding protein (GC Protein) is a multifunctional protein engaged in various physiological processes. It plays a pivotal role in the transport and storage of vitamin D, contributing to its systemic availability. Furthermore, GC Protein acts as a scavenger for extracellular G-actin, a crucial function in maintaining cellular homeostasis. In the context of inflammation, it enhances the chemotactic activity of C5 alpha for neutrophils, actively participating in immune responses. Additionally, GC Protein is implicated in macrophage activation, contributing to the orchestration of immune processes. Beyond its immune-related functions, GC Protein associates with membrane-bound immunoglobulin on B-lymphocytes and interacts with the IgG Fc receptor on T-lymphocyte membranes, suggesting its involvement in immune cell interactions. Notably, the interaction with LRP2 is essential for the renal uptake of GC in complex with 25-hydroxyvitamin D3, highlighting its significance in vitamin D metabolism and homeostasis.

Human

HEK293

C-6*His

P02774-1 (L17-L474)

2638  [NCBI]

LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL

Approximately 53.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.