1. Recombinant Proteins
  2. Others
  3. VNN2/Vanin-2 Protein, Human (HEK293, His)

VNN2/Vanin-2 Proteinas, an amidohydrolase, crucially hydrolyzes D-pantetheine's carboamide linkage, recycling pantothenic acid and releasing cysteamine. Apart from its vitamin metabolism role, VNN2 is involved in thymus homing of bone marrow cells and may regulate beta-2 integrin-mediated processes, influencing neutrophil adhesion, migration, and motility. VNN2/Vanin-2 Protein, Human (HEK293, His) is the recombinant human-derived VNN2/Vanin-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VNN2/Vanin-2 Proteinas, an amidohydrolase, crucially hydrolyzes D-pantetheine's carboamide linkage, recycling pantothenic acid and releasing cysteamine. Apart from its vitamin metabolism role, VNN2 is involved in thymus homing of bone marrow cells and may regulate beta-2 integrin-mediated processes, influencing neutrophil adhesion, migration, and motility. VNN2/Vanin-2 Protein, Human (HEK293, His) is the recombinant human-derived VNN2/Vanin-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Vanin-2 (VNN2) is an amidohydrolase that specifically hydrolyzes one of the carboamide linkages in D-pantetheine, playing a crucial role in the recycling of pantothenic acid (vitamin B5) and releasing cysteamine. Beyond its role in vitamin metabolism, VNN2 is involved in the thymus homing of bone marrow cells. Additionally, it may play a regulatory role in beta-2 integrin-mediated processes, influencing cell adhesion, migration, and the motility of neutrophils.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O95498 (Q23-S492)

Gene ID
Molecular Construction
N-term
VNN2 (Q23-S492)
Accession # O95498
6*His
C-term
Synonyms
Vascular Non-Inflammatory Molecule 2; Vanin-2; Glycosylphosphatidyl Inositol-Anchored Protein GPI-80; Protein FOAP-4; VNN2
AA Sequence

QDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDILETAIKQAAEQGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTPVQARLSCLAKDNSIYVLANLGDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKYHLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFYDPGVTLVKDFHVDTILFPTAWMNVLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAPNGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVETASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSS

Molecular Weight

Approximately 68.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

VNN2/Vanin-2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VNN2/Vanin-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P71045
Quantity:
MCE Japan Authorized Agent: