14-3-3 eta Protein, Human (GST)

YWHAH proteins are adapter proteins in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and regulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity and interacts with nuclear hormone receptors (AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP, THRA) and cofactors. 14-3-3 eta Protein, Human (GST) is the recombinant human-derived YWHAH protein, expressed by E. coli , with N-GST labeled tag.

The YWHAH protein functions as an adapter implicated in the regulation of a broad spectrum of both general and specialized signaling pathways, recognizing phosphoserine or phosphothreonine motifs to bind with numerous partners. This binding typically leads to the modulation of the activity of the interacting partner. YWHAH negatively regulates the kinase activity of PDPK1 and exists as a homodimer. It interacts with various nuclear hormone receptors and cofactors, including AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP, and THRA. Additionally, it interacts with ABL1 in its phosphorylated form, retaining it in the cytoplasm, and weakly interacts with CDKN1B. Other interactions involve ARHGEF28, CDK16, GAB2, KCNK18 (in a phosphorylation-dependent manner), SAMSN1, the 'Ser-241' phosphorylated form of PDPK1, the 'Thr-369' phosphorylated form of DAPK2, PI4KB, TBC1D22A, TBC1D22B, SLITRK1, and MEFV. These diverse interactions underscore the multifaceted role of YWHAH in various cellular processes and signaling pathways.

Human

E. coli

N-GST

Q04917 (R4-N246)

7533  [NCBI]

REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Approximately 54.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.