1. Recombinant Proteins
  2. Others
  3. 14-3-3 eta Protein, Human (GST)

YWHAH proteins are adapter proteins in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and regulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity and interacts with nuclear hormone receptors (AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP, THRA) and cofactors. 14-3-3 eta Protein, Human (GST) is the recombinant human-derived YWHAH protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

YWHAH proteins are adapter proteins in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and regulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity and interacts with nuclear hormone receptors (AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP, THRA) and cofactors. 14-3-3 eta Protein, Human (GST) is the recombinant human-derived YWHAH protein, expressed by E. coli , with N-GST labeled tag.

Background

The YWHAH protein functions as an adapter implicated in the regulation of a broad spectrum of both general and specialized signaling pathways, recognizing phosphoserine or phosphothreonine motifs to bind with numerous partners. This binding typically leads to the modulation of the activity of the interacting partner. YWHAH negatively regulates the kinase activity of PDPK1 and exists as a homodimer. It interacts with various nuclear hormone receptors and cofactors, including AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP, and THRA. Additionally, it interacts with ABL1 in its phosphorylated form, retaining it in the cytoplasm, and weakly interacts with CDKN1B. Other interactions involve ARHGEF28, CDK16, GAB2, KCNK18 (in a phosphorylation-dependent manner), SAMSN1, the 'Ser-241' phosphorylated form of PDPK1, the 'Thr-369' phosphorylated form of DAPK2, PI4KB, TBC1D22A, TBC1D22B, SLITRK1, and MEFV. These diverse interactions underscore the multifaceted role of YWHAH in various cellular processes and signaling pathways.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q04917 (R4-N246)

Gene ID
Molecular Construction
N-term
GST
YWHAH (R4-N246)
Accession # Q04917
C-term
Synonyms
14-3-3 protein eta; Brain protein 14-3-3; eta isoform; HGNC:12853; Protein AS1; YWHA 1; YWHA1; Ywhah
AA Sequence

REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Molecular Weight

Approximately 54.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

14-3-3 eta Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
14-3-3 eta Protein, Human (GST)
Cat. No.:
HY-P71682
Quantity:
MCE Japan Authorized Agent: