1. Recombinant Proteins
  2. Others
  3. ZBTB17 Protein, Human (His)

The ZBTB17 protein is a multifunctional transcription factor that functions as a binding partner-based activator or repressor and a targeted regulator of cell cycle progression. It is essential for early lymphocyte development, preventing apoptosis and ensuring lineage commitment. ZBTB17 Protein, Human (His) is the recombinant human-derived ZBTB17 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZBTB17 Protein, Human (His) is 188 a.a., with molecular weight of ~18.0-26.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ZBTB17 protein is a multifunctional transcription factor that functions as a binding partner-based activator or repressor and a targeted regulator of cell cycle progression. It is essential for early lymphocyte development, preventing apoptosis and ensuring lineage commitment. ZBTB17 Protein, Human (His) is the recombinant human-derived ZBTB17 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZBTB17 Protein, Human (His) is 188 a.a., with molecular weight of ~18.0-26.0 kDa.

Background

ZBTB17, a versatile transcription factor, functions as either an activator or repressor depending on its binding partners and its target negative regulators of cell cycle progression. It plays a crucial role in early lymphocyte development, preventing apoptosis in lymphoid precursors, enabling survival in response to IL7, and ensuring proper lineage commitment. ZBTB17 has been identified binding to the promoters of adenovirus major late protein and cyclin D1, activating transcription. Essential for early embryonic development during gastrulation, ZBTB17 also represses RB1 transcription, an effect counteracted by its interaction with ZBTB49 isoform 3/ZNF509S1. Through homooligomerization, required for DNA binding, ZBTB17 interacts with GIF1, leading to MYB recruitment to the CDKN1A/p21 and CDKN1B promoters, repressing transcription. Furthermore, it interacts with TRAF2, inhibiting TRAF2 E3 ligase activity, and associates with MYC, rendering ZBTB17 insoluble in the nucleus and inhibiting its transactivation and growth arrest activities. Additional interactions with HCFC1, MAGEA4, TMPRSS11A, and BCL6 further illustrate the intricate regulatory network orchestrated by ZBTB17 in cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q13105 (M1-A188)

Gene ID
Molecular Construction
N-term
6*His
ZBTB17 (M1-A188)
Accession # Q13105
C-term
Synonyms
Zinc Finger and BTB Domain-Containing Protein 17; Myc-Interacting Zinc Finger Protein 1; Miz-1; Zinc Finger Protein 151; Zinc Finger Protein 60; ZBTB17; MIZ1; ZNF151; ZNF60
AA Sequence

MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADA

Molecular Weight

Approximately 18.0-26.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

ZBTB17 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ZBTB17 Protein, Human (His)
Cat. No.:
HY-P71437
Quantity:
MCE Japan Authorized Agent: