ZBTB17 Protein, Human (His)

The ZBTB17 protein is a multifunctional transcription factor that functions as a binding partner-based activator or repressor and a targeted regulator of cell cycle progression. It is essential for early lymphocyte development, preventing apoptosis and ensuring lineage commitment. ZBTB17 Protein, Human (His) is the recombinant human-derived ZBTB17 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZBTB17 Protein, Human (His) is 188 a.a., with molecular weight of ~18.0-26.0 kDa.

ZBTB17, a versatile transcription factor, functions as either an activator or repressor depending on its binding partners and its target negative regulators of cell cycle progression. It plays a crucial role in early lymphocyte development, preventing apoptosis in lymphoid precursors, enabling survival in response to IL7, and ensuring proper lineage commitment. ZBTB17 has been identified binding to the promoters of adenovirus major late protein and cyclin D1, activating transcription. Essential for early embryonic development during gastrulation, ZBTB17 also represses RB1 transcription, an effect counteracted by its interaction with ZBTB49 isoform 3/ZNF509S1. Through homooligomerization, required for DNA binding, ZBTB17 interacts with GIF1, leading to MYB recruitment to the CDKN1A/p21 and CDKN1B promoters, repressing transcription. Furthermore, it interacts with TRAF2, inhibiting TRAF2 E3 ligase activity, and associates with MYC, rendering ZBTB17 insoluble in the nucleus and inhibiting its transactivation and growth arrest activities. Additional interactions with HCFC1, MAGEA4, TMPRSS11A, and BCL6 further illustrate the intricate regulatory network orchestrated by ZBTB17 in cellular processes.

Human

E. coli

N-6*His

Q13105 (M1-A188)

7709  [NCBI]

MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADA

Approximately 18.0-26.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.