1. Recombinant Proteins
  2. Others
  3. ZG16B Protein, Human (HEK293, His)

ZG16B Protein, Human (HEK293, His)

Cat. No.: HY-P700451
COA Handling Instructions

Zymogen granule protein 16 homolog B is a secretory lectin protein that is a highly expressed gene in human salivary gland tissue. Zymogen granule protein 16 homolog B shares sequence homology with its paralog, ZG16p, containing a NH2-terminal signal sequence, putative related lectin domains, and an N-linked glycosylation site. ZG16B Protein, Human (HEK293, His) is the recombinant human-derived ZG16B protein, expressed by HEK293 , with C-10*His labeled tag. The total length of ZG16B Protein, Human (HEK293, His) is 156 a.a., with molecular weight of ~26 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $150 In-stock
50 μg $300 In-stock
100 μg $510 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Zymogen granule protein 16 homolog B is a secretory lectin protein that is a highly expressed gene in human salivary gland tissue. Zymogen granule protein 16 homolog B shares sequence homology with its paralog, ZG16p, containing a NH2-terminal signal sequence, putative related lectin domains, and an N-linked glycosylation site. ZG16B Protein, Human (HEK293, His) is the recombinant human-derived ZG16B protein, expressed by HEK293 , with C-10*His labeled tag. The total length of ZG16B Protein, Human (HEK293, His) is 156 a.a., with molecular weight of ~26 kDa.

Background

Zymogen granule protein 16 homolog B enables carbohydrate binding activity. Zymogen granule protein 16 homolog B Involves in retina homeostasis. Zymogen granule protein 16 homolog B locates in extracellular exosome[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody, the EC50 is ≤95 ng/mL.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

Q96DA0 (G53-R208)

Gene ID
Molecular Construction
N-term
ZG16B (G53-R208)
Accession # Q96DA0
10*His
C-term
Synonyms
EECP; PAUF; JCLN2; HRPE773; PRO1567
AA Sequence

GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

Molecular Weight

Approximately 26 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ZG16B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ZG16B Protein, Human (HEK293, His)
Cat. No.:
HY-P700451
Quantity:
MCE Japan Authorized Agent: