2. GPCR/G Protein
  3. PTHR
  4. (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) 

Cat. No.: HY-P4715 Purity: 99.08%
SDS COA Handling Instructions

Molarity Calculator

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a peptide and can be used as a parathyroid hormone (PTH) receptor ligand.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) Chemical Structure

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) Chemical Structure

CAS No. : 213779-11-4

Size Price Stock Quantity
5 mg USD 170 In-stock
10 mg USD 270 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) Related Antibodies

Top Publications Citing Use of Products

View All PTHR Isoform Specific Products:

View All Isoforms
PTH1R

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a peptide and can be used as a parathyroid hormone (PTH) receptor ligand[1].

Molecular Weight

4309.85

Formula

C194H303N59O53
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr
Sequence Shortening

AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (23.20 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2320 mL 1.1601 mL 2.3203 mL
5 mM 0.0464 mL 0.2320 mL 0.4641 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2320 mL 1.1601 mL 2.3203 mL 5.8007 mL
5 mM 0.0464 mL 0.2320 mL 0.4641 mL 1.1601 mL
10 mM 0.0232 mL 0.1160 mL 0.2320 mL 0.5801 mL
15 mM 0.0155 mL 0.0773 mL 0.1547 mL 0.3867 mL
20 mM 0.0116 mL 0.0580 mL 0.1160 mL 0.2900 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)213779-11-4PTHRParathyroid hormone receptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)
Cat. No.:
HY-P4715
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.