1. GPCR/G Protein
  2. Natriuretic Peptide Receptor (NPR)
  3. Ularitide

Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Ularitide Chemical Structure

Ularitide Chemical Structure

CAS No. : 118812-69-4

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure[1][2][4][5].

In Vitro

Ularitide increases the amount of cyclic nucleotides and decreases the raise in permeability in HUVEC cells[2].
Ularitide (1 nM-1 μM, 15 min) reverses methacholine-evoked contraction in bovine bronchi[3].
Ularitide (1 μM, 0-300 s) increases cyclic GMP levels in the presence of phosphoramidon in bovine bronchi[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Ularitide (10 nmol/kg, s.c., once) increases in urine volume and sodium excretion in arteriovenous (AV) fistula dogs[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Female dogs with or without surgically induced chronic aortocaval fistula[1]
Dosage: 5 and 10 pmol/kg/min
Administration: i.v. infusions for for 75 min, and thereafter at 10 pmol/kg/min for another 75 min.
Result: Increased in urine volume and sodium excretion with high-output CHF.
Clinical Trial
Molecular Weight

3505.96

Formula

C145H234N52O44S3

CAS No.
Sequence

Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys11-Cys27)

Sequence Shortening

TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge:Cys11-Cys27)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ularitide
Cat. No.:
HY-P2687
Quantity:
MCE Japan Authorized Agent: