Ularitide (Synonyms: Urodilatin (human))

Cat. No.: HY-P2687: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure.

For research use only. We do not sell to patients.

Ularitide Chemical Structure

CAS No. : 118812-69-4

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

Ularitide increases the amount of cyclic nucleotides and decreases the raise in permeability in HUVEC cells^[2].
Ularitide (1 nM-1 μM, 15 min) reverses methacholine-evoked contraction in bovine bronchi^[3].
Ularitide (1 μM, 0-300 s) increases cyclic GMP levels in the presence of phosphoramidon in bovine bronchi^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Ularitide (10 nmol/kg, s.c., once) increases in urine volume and sodium excretion in arteriovenous (AV) fistula dogs^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Female dogs with or without surgically induced chronic aortocaval fistula^[1]
Dosage:	5 and 10 pmol/kg/min
Administration:	i.v. infusions for for 75 min, and thereafter at 10 pmol/kg/min for another 75 min.
Result:	Increased in urine volume and sodium excretion with high-output CHF.

Clinical Trial

Molecular Weight

3505.96

Formula

C₁₄₅H₂₃₄N₅₂O₄₄S₃

CAS No.

118812-69-4

Sequence

Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys11-Cys27)

Sequence Shortening

TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge:Cys11-Cys27)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Anker SD, et al. Ularitide for the treatment of acute decompensated heart failure: from preclinical to clinical studies. Eur Heart J. 2015 Mar 21;36(12):715-23.

[2]. Korn C, et al. Comparison of the effects of ularitide acetate and other bronchorelaxing substances on the thrombin-induced permeability raise of human endothelial cell monolayers. Arzneimittelforschung. 1998 Mar;48(3):251-8. [Content Brief]

[3]. Nally JE, et al. Bronchodilator and pre-protective effects of urodilatin in bovine bronchi in vitro: comparison with atrial natriuretic peptide. Br J Pharmacol. 1995 Apr;114(7):1391-6. [Content Brief]

[4]. Valentin JP, et al. Urodilatin binds to and activates renal receptors for atrial natriuretic peptide. Hypertension. 1993 Apr;21(4):432-8. [Content Brief]

[5]. Choi MR, et al. Urodilatin regulates renal dopamine metabolism. J Nephrol. 2013 Nov-Dec;26(6):1042-8. [Content Brief]

Ularitide Related Classifications

Cardiovascular Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Ularitide118812-69-4Urodilatin (human)OthersHeart failurenatriuretic peptidebovine bronchidopamine metabolismrenal receptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks