2. GPCR/G Protein
  3. CRFR
  4. Urocortin II, mouse

Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Urocortin II, mouse Chemical Structure

Urocortin II, mouse Chemical Structure

CAS No. : 330648-32-3

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Urocortin II, mouse Related Antibodies

Top Publications Citing Use of Products

View All CRFR Isoform Specific Products:

View All Isoforms
CRFR1 CRFR2

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow[1][2][3].

IC50 & Target[2]

CRFR2

0.66 nM (Ki)

CRFR1

﹥100 nM (Ki)

In Vitro

Urocortin II, mouse elicits positive inotropic and positive lusitropic effects in mouse ventricular myocytes via activation of CRF2 receptors[1].
Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca2+/CaMKII-dependent manner[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Urocortin II, mouse Related Antibodies
In Vivo

Urocortin II, mouse (1-10 μg; icv and i.v.; Adult male Sprague-Dawley rats) induces the expression of Fos[2].
Urocortin II, mouse (1 μg; icv; Adult male Sprague-Dawley rats) is involved in central autonomic nervous system and appetite control[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Adult male Sprague-Dawley rats (250-300 g)[2]
Dosage: 1, 5, and 10 μg
Administration: Intracerebroventrical injection and intravenous injection; 1, 5, or 10 μg per animal in 2 μL of saline for i.c.v. injections or 200 μL for i.v. administration
Result: Induced Fos expression in a dose-dependent manner.
Animal Model: Adult male Sprague-Dawley rats (250-300 g)[2]
Dosage: 1 μg
Administration: Intracerebroventrical injection
Result: Reduced food intake over the 12-h interval.
Molecular Weight

4152.96

Formula

C187H320N56O50
CAS No.
Sequence

Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2
Sequence Shortening

VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Urocortin II, mouse Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Urocortin II, mouse330648-32-3CRFRCorticotropin-releasing Factor ReceptorCRHRendogenous peptidemouse ventricular myocytescentral nervous systemdiscrete areavisceral sensory informationInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Urocortin II, mouse
Cat. No.:
HY-P2847
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.