Urocortin II, mouse

Name: Urocortin II, mouse
Brand: MedChemExpress
SKU: HY-P2847
Rating: 4.5 (1 reviews)

Cat. No.: HY-P2847 Purity: 98.63%: FAQs
Data Sheet
SDS

COA
Handling Instructions Technical Support

Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with K_i values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca²⁺/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Urocortin II, mouse Chemical Structure

CAS No. : 330648-32-3

Size	Stock	Quantity
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	In-stock	Estimated Time of Arrival: December 31
50 mg	Get quote
100 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All CRFR Isoform Specific Products:

View All Isoforms

CRFR1 CRFR2

Biological Activity
Purity & Documentation
References
Customer Review

Description

IC₅₀ & Target^[2]

CRFR2

0.66 nM (Ki)

CRFR1

﹥100 nM (Ki)

In Vitro

Urocortin II, mouse elicits positive inotropic and positive lusitropic effects in mouse ventricular myocytes via activation of CRF2 receptors^[1].
Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca²⁺/CaMKII-dependent manner^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Urocortin II, mouse (1-10 μg; icv and i.v.; Adult male Sprague-Dawley rats) induces the expression of Fos^[2].
Urocortin II, mouse (1 μg; icv; Adult male Sprague-Dawley rats) is involved in central autonomic nervous system and appetite control^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Adult male Sprague-Dawley rats (250-300 g)^[2]
Dosage:	1, 5, and 10 μg
Administration:	Intracerebroventrical injection and intravenous injection; 1, 5, or 10 μg per animal in 2 μL of saline for i.c.v. injections or 200 μL for i.v. administration
Result:	Induced Fos expression in a dose-dependent manner.

Animal Model:	Adult male Sprague-Dawley rats (250-300 g)^[2]
Dosage:	1 μg
Administration:	Intracerebroventrical injection
Result:	Reduced food intake over the 12-h interval.

Molecular Weight

4152.96

Formula

C₁₈₇H₃₂₀N₅₆O₅₀

CAS No.

330648-32-3

Appearance

Solid

Color

White to off-white

Sequence

Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2

Sequence Shortening

VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

DMSO : 50 mg/mL (12.04 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2408 mL	1.2040 mL	2.4079 mL
5 mM	0.0482 mL	0.2408 mL	0.4816 mL
10 mM	0.0241 mL	0.1204 mL	0.2408 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

Purity & Documentation

Purity: 98.63%

Select Batch:

Data Sheet (286 KB) SDS (252 KB)

COA (262 KB) RP-HPLC (110 KB) MS (201 KB)

Handling Instructions (2659 KB)

References

[1]. Yang LZ, et, al. cAMP- and Ca²(+) /calmodulin-dependent protein kinases mediate inotropic, lusitropic and arrhythmogenic effects of urocortin 2 in mouse ventricular myocytes. Br J Pharmacol. 2011 Jan;162(2):544-56. [Content Brief]

[2]. Reyes TM, et, al. Urocortin II: a member of the corticotropin-releasing factor (CRF) neuropeptide family that is selectively bound by type 2 CRF receptors. Proc Natl Acad Sci U S A. 2001 Feb 27;98(5):2843-8. [Content Brief]

[3]. Reyes TM, et, al. Urocortin II: a member of the corticotropin-releasing factor (CRF) neuropeptide family that is selectively bound by type 2 CRF receptors. Proc Natl Acad Sci U S A. 2001 Feb 27;98(5):2843-8. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

DMSO	1 mM	0.2408 mL	1.2040 mL	2.4079 mL	6.0198 mL
	5 mM	0.0482 mL	0.2408 mL	0.4816 mL	1.2040 mL
	10 mM	0.0241 mL	0.1204 mL	0.2408 mL	0.6020 mL