Urocortin III, mouse TFA

Name: Urocortin III, mouse TFA
Brand: MedChemExpress
SKU: HY-P1858A
Rating: 4.5 (1 reviews)

Cat. No.: HY-P1858A Purity: 95.27%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Urocortin III, mouse TFA Chemical Structure

Size	Price	Stock	Quantity
5 mg	USD 500	In-stock	Estimated Time of Arrival: December 31
10 mg	USD 850	In-stock	Estimated Time of Arrival: December 31
50 mg		Get quote
100 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Urocortin III, mouse TFA:

Urocortin III, mouse Get quote

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

View All CRFR Isoform Specific Products:

View All Isoforms

CRFR1 CRFR2

Biological Activity
Purity & Documentation
References
Customer Review

Description

Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2^[1]. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics^[2].

Molecular Weight

4172.97 (free base)

Formula

C₁₈₆H₃₁₂N₅₂O₅₂S₂.xC₂HF₃O₂

Appearance

Solid

Color

White to off-white

Sequence

Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2

Sequence Shortening

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

H₂O : 25 mg/mL (Need ultrasonic)

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 95.27%

Select Batch:

Data Sheet (264 KB) SDS (252 KB)

COA (242 KB) RP-HPLC (162 KB) Elemental Analysis Report (100 KB)

Handling Instructions (2659 KB)

References

[1]. Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7570-5. Lewis K, et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. [Content Brief]

[2]. Shemesh Y, et al. Ucn3 and CRF-R2 in the medial amygdala regulate complex social dynamics. Nat Neurosci. 2016 Nov;19(11):1489-1496. [Content Brief]